Lineage for d1jewr_ (1jew R:)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1972644Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 1972645Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 1972646Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)
  6. 1972656Protein Coxsackievirus b3 (m strain) with its cellular receptor car [69994] (1 species)
  7. 1972657Species Human (Homo sapiens) [TaxId:9606] [69995] (1 PDB entry)
  8. 1972662Domain d1jewr_: 1jew R: [66618]

Details for d1jewr_

PDB Entry: 1jew (more details), 22 Å

PDB Description: cryo-em structure of coxsackievirus b3(m strain) with its cellular receptor, coxsackievirus and adenovirus receptor (car).
PDB Compounds: (R:) coxsackievirus and adenovirus receptor

SCOPe Domain Sequences for d1jewr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jewr_ i.6.1.1 (R:) Coxsackievirus b3 (m strain) with its cellular receptor car {Human (Homo sapiens) [TaxId: 9606]}
sittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiy
ddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvlvk

SCOPe Domain Coordinates for d1jewr_:

Click to download the PDB-style file with coordinates for d1jewr_.
(The format of our PDB-style files is described here.)

Timeline for d1jewr_: