Lineage for d1jewr_ (1jew R:)

  1. Root: SCOP 1.59
  2. 146111Class i: Low resolution protein structures [58117] (16 folds)
  3. 146555Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 146556Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 146557Family i.6.1.1: Viruses and virus-receptor complexes [58164] (7 proteins)
  6. Protein Coxsackievirus b3(m strain) with its cellular receptor car [69994] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [69995] (1 PDB entry)
  8. 146564Domain d1jewr_: 1jew R: [66618]

Details for d1jewr_

PDB Entry: 1jew (more details)

PDB Description: cryo-em structure of coxsackievirus b3(m strain) with its cellular receptor, coxsackievirus and adenovirus receptor (car).

SCOP Domain Sequences for d1jewr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jewr_ i.6.1.1 (R:) Coxsackievirus b3(m strain) with its cellular receptor car {Human (Homo sapiens)}
sittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiy
ddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvlvk

SCOP Domain Coordinates for d1jewr_:

Click to download the PDB-style file with coordinates for d1jewr_.
(The format of our PDB-style files is described here.)

Timeline for d1jewr_: