| Class i: Low resolution protein structures [58117] (24 folds) |
| Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily) |
Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) ![]() |
| Family i.6.1.1: Viruses and virus-receptor complexes [58164] (11 proteins) |
| Protein Coxsackievirus b3 (m strain) with its cellular receptor car [69994] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [69995] (1 PDB entry) |
| Domain d1jewr_: 1jew R: [66618] |
PDB Entry: 1jew (more details)
SCOP Domain Sequences for d1jewr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jewr_ i.6.1.1 (R:) Coxsackievirus b3 (m strain) with its cellular receptor car {Human (Homo sapiens)}
sittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiy
ddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvlvk
Timeline for d1jewr_:
View in 3DDomains from other chains: (mouse over for more information) d1jew1_, d1jew2_, d1jew3_, d1jew4_ |