SCOPe 2.02: Domain d1jew3_: 1jew 3:

Lineage for d1jew3_ (1jew 3:)

1. Root: SCOPe 2.02

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)

4. Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family)

5. Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)

6. Protein Coxsackievirus b3 (m strain) with its cellular receptor car [69994] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69995] (1 PDB entry)

8. Domain d1jew3_: 1jew 3: [66616]

Details for d1jew3_

PDB Entry: 1jew, 22 Å

PDB Description: cryo-em structure of coxsackievirus b3(m strain) with its cellular receptor, coxsackievirus and adenovirus receptor (car).

PDB Compounds: (3:) coxsackievirus capsid, coat protein vp3

SCOPe Domain Sequences for d1jew3_:

Sequence; same for both SEQRES and ATOM records:

>d1jew3_ i.6.1.1 (3:) Coxsackievirus b3 (m strain) with its cellular receptor car {Human (Homo sapiens) [TaxId: 9606]}
glptmntpgscqfltsddfqspsampqydvtpemripgevknlmeiaevdsvvpvqnvge
kvnsmeayqipvrsnegsgtqvfgfplqpgyssvfsrtllgeilnyythwsgsikltfmf
cgsamatgkfllaysppgagaptkrvdamlgthvvwdvglqsscvlcipwisqthyryva
sdeytaggfitcwyqtnivvpadaqsscyimcfvsacndfsvrllkdtpfisqenffq

Timeline for d1jew3_:

• d1jew3_ first appeared in SCOP 1.59
  
• d1jew3_ appears in SCOPe 2.01
  
• d1jew3_ appears in SCOPe 2.03
  
• d1jew3_ appears in the current release, SCOPe 2.08