Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (3 species) |
Species Sulfolobus solfataricus [TaxId:2287] [69536] (9 PDB entries) |
Domain d1je1b_: 1je1 B: [66585] complexed with gmp, so4 |
PDB Entry: 1je1 (more details), 1.8 Å
SCOPe Domain Sequences for d1je1b_:
Sequence, based on SEQRES records: (download)
>d1je1b_ c.56.2.1 (B:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Sulfolobus solfataricus [TaxId: 2287]} npvhilakkgevaervlvvgdpgrarllstllqnpkltnenrgflvytgkyngetvsiat hgiggpsiaivleelamlganvfirygttgalvpyinlgeyiivtgasynqgglfyqylr dnacvastpdfeltnklvtsfskrnlkyyvgnvfssdafyaedeefvkkwssrgniavem ecatlftlskvkgwksatvlvvsdnlakggiwitkeeleksvmdgakavldtlts
>d1je1b_ c.56.2.1 (B:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Sulfolobus solfataricus [TaxId: 2287]} npvhilakkgevaervlvvgdpgrarllstllqnpkltnenrgflvytgkyngetvsiat hgiggpsiaivleelamlganvfirygttgalvpyinlgeyiivtgasynqgglfyqylr dnacvastpdfeltnklvtsfskrnlkyyvgnvfssdafyaedeefvkkwssrgniavem ecatlftlskvkgwksatvlvvsdnlakitkeeleksvmdgakavldtlts
Timeline for d1je1b_: