Lineage for d1jdvd_ (1jdv D:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 246616Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 246632Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 246633Family c.56.2.1: Purine and uridine phosphorylases [53168] (4 proteins)
  6. 246634Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (2 species)
  7. 246635Species Archaeon Sulfolobus solfataricus [TaxId:2287] [69536] (9 PDB entries)
  8. 246663Domain d1jdvd_: 1jdv D: [66575]

Details for d1jdvd_

PDB Entry: 1jdv (more details), 2 Å

PDB Description: crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with adenosine and sulfate ion

SCOP Domain Sequences for d1jdvd_:

Sequence, based on SEQRES records: (download)

>d1jdvd_ c.56.2.1 (D:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Archaeon Sulfolobus solfataricus}
npvhilakkgevaervlvvgdpgrarllstllqnpkltnenrgflvytgkyngetvsiat
hgiggpsiaivleelamlganvfirygttgalvpyinlgeyiivtgasynqgglfyqylr
dnacvastpdfeltnklvtsfskrnlkyyvgnvfssdafyaedeefvkkwssrgniavem
ecatlftlskvkgwksatvlvvsdnlakggiwitkeeleksvmdgakavldtlts

Sequence, based on observed residues (ATOM records): (download)

>d1jdvd_ c.56.2.1 (D:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Archaeon Sulfolobus solfataricus}
npvhilakkgevaervlvvgdpgrarllstllqnpkltnenrgflvytgkyngetvsiat
hgiggpsiaivleelamlganvfirygttgalvpyinlgeyiivtgasynqgglfyqylr
dnacvastpdfeltnklvtsfskrnlkyyvgnvfssdafyaedeefvkkwssrgniavem
ecatlftlskvkgwksatvlvvsdnlakeleksvmdgakavldtlts

SCOP Domain Coordinates for d1jdvd_:

Click to download the PDB-style file with coordinates for d1jdvd_.
(The format of our PDB-style files is described here.)

Timeline for d1jdvd_: