Lineage for d1jdsc_ (1jds C:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 317273Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 317289Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 317290Family c.56.2.1: Purine and uridine phosphorylases [53168] (4 proteins)
  6. 317291Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (2 species)
  7. 317292Species Archaeon Sulfolobus solfataricus [TaxId:2287] [69536] (9 PDB entries)
  8. 317298Domain d1jdsc_: 1jds C: [66562]

Details for d1jdsc_

PDB Entry: 1jds (more details), 1.8 Å

PDB Description: 5'-deoxy-5'-methylthioadenosine phosphorylase complex with phosphate (space group p21)

SCOP Domain Sequences for d1jdsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdsc_ c.56.2.1 (C:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Archaeon Sulfolobus solfataricus}
pvhilakkgevaervlvvgdpgrarllstllqnpkltnenrgflvytgkyngetvsiath
giggpsiaivleelamlganvfirygttgalvpyinlgeyiivtgasynqgglfyqylrd
nacvastpdfeltnklvtsfskrnlkyyvgnvfssdafyaedeefvkkwssrgniaveme
catlftlskvkgwksatvlvvsdnlakggiwitkeeleksvmdgakavldtlts

SCOP Domain Coordinates for d1jdsc_:

Click to download the PDB-style file with coordinates for d1jdsc_.
(The format of our PDB-style files is described here.)

Timeline for d1jdsc_: