Lineage for d1jdqa1 (1jdq A:20-98)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957373Superfamily d.68.3: SirA-like [64307] (1 family) (S)
  5. 2957374Family d.68.3.3: SirA-like [88852] (5 proteins)
    predicted redox protein, regulator of disulfide bond formation
  6. 2957378Protein Hypothetical protein TM0983 [69751] (1 species)
  7. 2957379Species Thermotoga maritima [TaxId:2336] [69752] (1 PDB entry)
  8. 2957380Domain d1jdqa1: 1jdq A:20-98 [66559]
    Other proteins in same PDB: d1jdqa2
    structural genomics

Details for d1jdqa1

PDB Entry: 1jdq (more details)

PDB Description: solution structure of tm006 protein from thermotoga maritima
PDB Compounds: (A:) hypothetical protein tm0983

SCOPe Domain Sequences for d1jdqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdqa1 d.68.3.3 (A:20-98) Hypothetical protein TM0983 {Thermotoga maritima [TaxId: 2336]}
makyqvtktldvrgevcpvpdvetkralqnmkpgeilevwidypmskeripetvkklghe
vleieevgpsewkiyikvk

SCOPe Domain Coordinates for d1jdqa1:

Click to download the PDB-style file with coordinates for d1jdqa1.
(The format of our PDB-style files is described here.)

Timeline for d1jdqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jdqa2