![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
![]() | Superfamily d.68.3: SirA-like [64307] (1 family) ![]() |
![]() | Family d.68.3.3: SirA-like [88852] (5 proteins) predicted redox protein, regulator of disulfide bond formation |
![]() | Protein Hypothetical protein TM0983 [69751] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [69752] (1 PDB entry) |
![]() | Domain d1jdqa1: 1jdq A:20-98 [66559] Other proteins in same PDB: d1jdqa2 structural genomics |
PDB Entry: 1jdq (more details)
SCOPe Domain Sequences for d1jdqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jdqa1 d.68.3.3 (A:20-98) Hypothetical protein TM0983 {Thermotoga maritima [TaxId: 2336]} makyqvtktldvrgevcpvpdvetkralqnmkpgeilevwidypmskeripetvkklghe vleieevgpsewkiyikvk
Timeline for d1jdqa1: