Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.68: IF3-like [55199] (3 superfamilies) |
Superfamily d.68.3: SirA-like [64307] (2 families) |
Family d.68.3.2: Hypothetical protein TM0983 [69750] (1 protein) |
Protein Hypothetical protein TM0983 [69751] (1 species) |
Species Thermotoga maritima [TaxId:243274] [69752] (1 PDB entry) |
Domain d1jdqa_: 1jdq A: [66559] |
PDB Entry: 1jdq (more details)
SCOP Domain Sequences for d1jdqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jdqa_ d.68.3.2 (A:) Hypothetical protein TM0983 {Thermotoga maritima} gsshhhhhhssglvprgshmakyqvtktldvrgevcpvpdvetkralqnmkpgeilevwi dypmskeripetvkklghevleieevgpsewkiyikvk
Timeline for d1jdqa_: