Lineage for d1jdqa_ (1jdq A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 134472Fold d.68: IF3-like [55199] (3 superfamilies)
  4. 134511Superfamily d.68.3: SirA-like [64307] (2 families) (S)
  5. 134516Family d.68.3.2: Hypothetical protein TM0983 [69750] (1 protein)
  6. 134517Protein Hypothetical protein TM0983 [69751] (1 species)
  7. 134518Species Thermotoga maritima [TaxId:243274] [69752] (1 PDB entry)
  8. 134519Domain d1jdqa_: 1jdq A: [66559]

Details for d1jdqa_

PDB Entry: 1jdq (more details)

PDB Description: solution structure of tm006 protein from thermotoga maritima

SCOP Domain Sequences for d1jdqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdqa_ d.68.3.2 (A:) Hypothetical protein TM0983 {Thermotoga maritima}
gsshhhhhhssglvprgshmakyqvtktldvrgevcpvpdvetkralqnmkpgeilevwi
dypmskeripetvkklghevleieevgpsewkiyikvk

SCOP Domain Coordinates for d1jdqa_:

Click to download the PDB-style file with coordinates for d1jdqa_.
(The format of our PDB-style files is described here.)

Timeline for d1jdqa_: