| Class g: Small proteins [56992] (66 folds) |
| Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) ![]() |
| Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (4 proteins) |
| Protein BIR2 domain of DIAP1 [69974] (1 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69975] (3 PDB entries) |
| Domain d1jd5a_: 1jd5 A: [66544] complexed wit grim peptide complexed with zn |
PDB Entry: 1jd5 (more details), 1.9 Å
SCOP Domain Sequences for d1jd5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jd5a_ g.52.1.1 (A:) BIR2 domain of DIAP1 {Fruit fly (Drosophila melanogaster)}
gnyfpqypeyaietarlrtfeawprnlkqkphqlaeagffytgvgdrvrcfscggglmdw
ndndepweqhalwlsqcrfvklmkgqlyidtvaakpvlaeekees
Timeline for d1jd5a_: