Lineage for d1jd5a_ (1jd5 A:)
- Root: SCOP 1.59
Class g: Small proteins [56992] (58 folds) 
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) 
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (4 proteins) Protein BIR2 domain of DIAP1 [69974] (1 species) Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69975] (3 PDB entries) 
Domain d1jd5a_: 1jd5 A: [66544]
Details for d1jd5a_
PDB Entry: 1jd5 (more details), 1.9 Å
PDB Description: crystal structure of diap1-bir2/grim
SCOP Domain Sequences for d1jd5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jd5a_ g.52.1.1 (A:) BIR2 domain of DIAP1 {Fruit fly (Drosophila melanogaster)}
gnyfpqypeyaietarlrtfeawprnlkqkphqlaeagffytgvgdrvrcfscggglmdw
ndndepweqhalwlsqcrfvklmkgqlyidtvaakpvlaeekees
SCOP Domain Coordinates for d1jd5a_:
Click to download the PDB-style file with coordinates for d1jd5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jd5a_:
- d1jd5a_ is new in SCOP 1.59
- d1jd5a_ appears in SCOP 1.61
- d1jd5a_ appears in the current release, SCOPe 2.08
View in 3D