Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily) |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) |
Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (4 PDB entries) |
Domain d1jd2u_: 1jd2 U: [66536] Other proteins in same PDB: d1jd21_, d1jd22_, d1jd2h_, d1jd2i_, d1jd2j_, d1jd2k_, d1jd2l_, d1jd2m_, d1jd2n_, d1jd2v_, d1jd2w_, d1jd2x_, d1jd2y_, d1jd2z_ |
PDB Entry: 1jd2 (more details), 3 Å
SCOP Domain Sequences for d1jd2u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jd2u_ d.153.1.4 (U:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae)} tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta agverlifypdeyeql
Timeline for d1jd2u_:
View in 3D Domains from other chains: (mouse over for more information) d1jd21_, d1jd22_, d1jd2a_, d1jd2b_, d1jd2c_, d1jd2d_, d1jd2e_, d1jd2f_, d1jd2g_, d1jd2h_, d1jd2i_, d1jd2j_, d1jd2k_, d1jd2l_, d1jd2m_, d1jd2n_, d1jd2o_, d1jd2p_, d1jd2q_, d1jd2r_, d1jd2s_, d1jd2t_, d1jd2v_, d1jd2w_, d1jd2x_, d1jd2y_, d1jd2z_ |