Lineage for d1jchc3 (1jch C:316-454)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2646825Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2646930Superfamily h.4.9: Colicin E3 receptor domain [69985] (1 family) (S)
  5. 2646931Family h.4.9.1: Colicin E3 receptor domain [69986] (1 protein)
  6. 2646932Protein Colicin E3 receptor domain [69987] (1 species)
  7. 2646933Species Escherichia coli [TaxId:562] [69988] (4 PDB entries)
  8. 2646939Domain d1jchc3: 1jch C:316-454 [66497]
    Other proteins in same PDB: d1jcha1, d1jcha2, d1jchb_, d1jchc1, d1jchc2, d1jchd_
    protein/RNA complex; complexed with cit, gol

Details for d1jchc3

PDB Entry: 1jch (more details), 3.02 Å

PDB Description: Crystal Structure of Colicin E3 in Complex with its Immunity Protein
PDB Compounds: (C:) Colicin E3

SCOPe Domain Sequences for d1jchc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jchc3 h.4.9.1 (C:316-454) Colicin E3 receptor domain {Escherichia coli [TaxId: 562]}
veaaernyeraraelnqanedvarnqerqakavqvynsrkseldaanktladaiaeikqf
nrfahdpmagghrmwqmaglkaqraqtdvnnkqaafdaaakeksdadaalssamesrkkk
edkkrsaennlndeknkpr

SCOPe Domain Coordinates for d1jchc3:

Click to download the PDB-style file with coordinates for d1jchc3.
(The format of our PDB-style files is described here.)

Timeline for d1jchc3: