Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies) this is not a true fold; contains at least two very long antiparallel helices |
Superfamily h.4.9: Colicin E3 receptor domain [69985] (1 family) |
Family h.4.9.1: Colicin E3 receptor domain [69986] (1 protein) |
Protein Colicin E3 receptor domain [69987] (1 species) |
Species Escherichia coli [TaxId:562] [69988] (4 PDB entries) |
Domain d1jchc3: 1jch C:316-454 [66497] Other proteins in same PDB: d1jcha1, d1jcha2, d1jchb_, d1jchc1, d1jchc2, d1jchd_ protein/RNA complex; complexed with cit, gol |
PDB Entry: 1jch (more details), 3.02 Å
SCOPe Domain Sequences for d1jchc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jchc3 h.4.9.1 (C:316-454) Colicin E3 receptor domain {Escherichia coli [TaxId: 562]} veaaernyeraraelnqanedvarnqerqakavqvynsrkseldaanktladaiaeikqf nrfahdpmagghrmwqmaglkaqraqtdvnnkqaafdaaakeksdadaalssamesrkkk edkkrsaennlndeknkpr
Timeline for d1jchc3: