Lineage for d1j7wd_ (1j7w D:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 93450Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 93460Family a.1.1.2: Globins [46463] (18 proteins)
  6. 93770Protein Hemoglobin, beta-chain [46500] (18 species)
  7. 93817Species Human (Homo sapiens) [TaxId:9606] [46501] (76 PDB entries)
  8. 93895Domain d1j7wd_: 1j7w D: [66424]
    Other proteins in same PDB: d1j7wa_, d1j7wc_

Details for d1j7wd_

PDB Entry: 1j7w (more details), 2 Å

PDB Description: crystal structure of deoxy hbbetayq, a site directed mutant of hba
PDB Compounds: (D:)

SCOP Domain Sequences for d1j7wd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j7wd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens)}
mhltpeeksavtalwgkvnvdevggeaygrllvvypwtqrffesfgdlstpdavmgnpkv
kaqgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1j7wd_:

Click to download the PDB-style file with coordinates for d1j7wd_.
(The format of our PDB-style files is described here.)

Timeline for d1j7wd_: