Lineage for d1j7ea2 (1j7e A:199-386)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1281391Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1281392Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 1281393Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 1281703Protein Vitamin D binding protein [69111] (1 species)
    domain 3 lacks the last subdomain
  7. 1281704Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)
  8. 1281724Domain d1j7ea2: 1j7e A:199-386 [66404]
    complexed with jy, ola

Details for d1j7ea2

PDB Entry: 1j7e (more details), 2.55 Å

PDB Description: a structural basis for the unique binding features of the human vitamin d-binding protein
PDB Compounds: (A:) vitamin D binding protein

SCOPe Domain Sequences for d1j7ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j7ea2 a.126.1.1 (A:199-386) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
lsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaeditnilskccesasedcm
akelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaqlpelpdvelptnkdv
cdpgntkvmdkytfelsrrthlpevflskvleptlkslgeccdvedsttcfnakgpllkk
elssfidk

SCOPe Domain Coordinates for d1j7ea2:

Click to download the PDB-style file with coordinates for d1j7ea2.
(The format of our PDB-style files is described here.)

Timeline for d1j7ea2: