SCOPe 2.03: Domain d1j7ea3: 1j7e A:387-457

Lineage for d1j7ea3 (1j7e A:387-457)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (1 family)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Vitamin D binding protein [69111] (1 species)
   domain 3 lacks the last subdomain

7. Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)

8. Domain d1j7ea3: 1j7e A:387-457 [66405]
   complexed with jy, ola

Details for d1j7ea3

PDB Entry: 1j7e, 2.55 Å

PDB Description: a structural basis for the unique binding features of the human vitamin d-binding protein

PDB Compounds: (A:) vitamin D binding protein

SCOPe Domain Sequences for d1j7ea3:

Sequence; same for both SEQRES and ATOM records:

>d1j7ea3 a.126.1.1 (A:387-457) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
gqelcadysentfteykkklaerlkaklpdatptelaklvnkrsdfasnccsinspplyc
dseidaelkni

Timeline for d1j7ea3:

• d1j7ea3 first appeared in SCOP 1.59
  
• d1j7ea3 appears in SCOPe 2.02
  
• d1j7ea3 appears in SCOPe 2.04
  
• d1j7ea3 appears in the current release, SCOPe 2.08