Lineage for d1j78b3 (1j78 B:387-456)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1748371Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1748372Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 1748373Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 1748677Protein Vitamin D binding protein [69111] (1 species)
    domain 3 lacks the last subdomain
  7. 1748678Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)
  8. 1748696Domain d1j78b3: 1j78 B:387-456 [66402]
    complexed with ola, vdy

Details for d1j78b3

PDB Entry: 1j78 (more details), 2.31 Å

PDB Description: crystallographic analysis of the human vitamin d binding protein
PDB Compounds: (B:) vitamin D binding protein

SCOPe Domain Sequences for d1j78b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j78b3 a.126.1.1 (B:387-456) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
gqelcadysentfteykkklaerlkaklpdatptelaklvnkrsdfasnccsinspplyc
dseidaelkn

SCOPe Domain Coordinates for d1j78b3:

Click to download the PDB-style file with coordinates for d1j78b3.
(The format of our PDB-style files is described here.)

Timeline for d1j78b3: