Lineage for d1iszb2 (1isz B:501-803)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1569213Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1569732Protein Xylanase A, catalytic core [51514] (8 species)
  7. 1569788Species Streptomyces olivaceoviridis [TaxId:1921] [51519] (12 PDB entries)
    Uniprot Q7SI98
    N-terminal domain; fused with a ricin A-like beta-trefoil domain
  8. 1569794Domain d1iszb2: 1isz B:501-803 [66360]
    Other proteins in same PDB: d1isza1, d1iszb1
    complexed with gal

Details for d1iszb2

PDB Entry: 1isz (more details), 2 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with galactose
PDB Compounds: (B:) endo-1,4-beta-D-xylanase

SCOPe Domain Sequences for d1iszb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iszb2 c.1.8.3 (B:501-803) Xylanase A, catalytic core {Streptomyces olivaceoviridis [TaxId: 1921]}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
ngg

SCOPe Domain Coordinates for d1iszb2:

Click to download the PDB-style file with coordinates for d1iszb2.
(The format of our PDB-style files is described here.)

Timeline for d1iszb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iszb1