| Class b: All beta proteins [48724] (141 folds) |
| Fold b.42: beta-Trefoil [50352] (6 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) ![]() |
| Family b.42.2.1: Ricin B-like [50371] (3 proteins) |
| Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species) |
| Species Streptomyces olivaceoviridis [TaxId:1921] [50378] (11 PDB entries) |
| Domain d1isyb1: 1isy B:804-936 [66355] Other proteins in same PDB: d1isya2, d1isyb2 complexed with glc |
PDB Entry: 1isy (more details), 2.1 Å
SCOP Domain Sequences for d1isyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1isyb1 b.42.2.1 (B:804-936) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces olivaceoviridis}
sstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygd
kcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqly
scsngsnqrwtrt
Timeline for d1isyb1: