Lineage for d1isyb1 (1isy B:804-936)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464258Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 464433Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 464434Family b.42.2.1: Ricin B-like [50371] (6 proteins)
  6. 464491Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species)
  7. 464496Species Streptomyces olivaceoviridis [TaxId:1921] [50378] (11 PDB entries)
  8. 464512Domain d1isyb1: 1isy B:804-936 [66355]
    Other proteins in same PDB: d1isya2, d1isyb2

Details for d1isyb1

PDB Entry: 1isy (more details), 2.1 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with glucose

SCOP Domain Sequences for d1isyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1isyb1 b.42.2.1 (B:804-936) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces olivaceoviridis}
sstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygd
kcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqly
scsngsnqrwtrt

SCOP Domain Coordinates for d1isyb1:

Click to download the PDB-style file with coordinates for d1isyb1.
(The format of our PDB-style files is described here.)

Timeline for d1isyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1isyb2