Lineage for d1iqra1 (1iqr A:172-416)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541571Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 541572Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (1 family) (S)
  5. 541573Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (2 proteins)
  6. 541574Protein C-terminal domain of DNA photolyase [48175] (3 species)
    N-terminal domain is alpha/beta and binds a light-harvesting cofactor
  7. 541589Species Thermus thermophilus [TaxId:274] [69083] (2 PDB entries)
  8. 541590Domain d1iqra1: 1iqr A:172-416 [66275]
    Other proteins in same PDB: d1iqra2
    complexed with fad, po4

Details for d1iqra1

PDB Entry: 1iqr (more details), 2.1 Å

PDB Description: Crystal structure of DNA photolyase from Thermus thermophilus

SCOP Domain Sequences for d1iqra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqra1 a.99.1.1 (A:172-416) C-terminal domain of DNA photolyase {Thermus thermophilus}
lplpepgeeaalaglrafleaklpryaeerdrldgeggsrlspyfalgvlsprlaaweae
rrggegarkwvaellwrdfsyhllyhfpwmaerpldprfqafpwqedealfqawyegktg
vplvdaamrelhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdravnlqgw
qwagglgvdaapyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdleearrryl
rlard

SCOP Domain Coordinates for d1iqra1:

Click to download the PDB-style file with coordinates for d1iqra1.
(The format of our PDB-style files is described here.)

Timeline for d1iqra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iqra2