Lineage for d1iqra1 (1iqr A:172-416)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99940Fold a.99: FAD-binding (C-terminal) domain of DNA photolyase [48172] (1 superfamily)
  4. 99941Superfamily a.99.1: FAD-binding (C-terminal) domain of DNA photolyase [48173] (1 family) (S)
  5. 99942Family a.99.1.1: FAD-binding (C-terminal) domain of DNA photolyase [48174] (1 protein)
  6. 99943Protein FAD-binding (C-terminal) domain of DNA photolyase [48175] (3 species)
  7. 99949Species Thermus thermophilus [TaxId:274] [69083] (1 PDB entry)
  8. 99950Domain d1iqra1: 1iqr A:172-416 [66275]
    Other proteins in same PDB: d1iqra2

Details for d1iqra1

PDB Entry: 1iqr (more details), 2.1 Å

PDB Description: Crystal structure of DNA photolyase from Thermus thermophilus

SCOP Domain Sequences for d1iqra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqra1 a.99.1.1 (A:172-416) FAD-binding (C-terminal) domain of DNA photolyase {Thermus thermophilus}
lplpepgeeaalaglrafleaklpryaeerdrldgeggsrlspyfalgvlsprlaaweae
rrggegarkwvaellwrdfsyhllyhfpwmaerpldprfqafpwqedealfqawyegktg
vplvdaamrelhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdravnlqgw
qwagglgvdaapyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdleearrryl
rlard

SCOP Domain Coordinates for d1iqra1:

Click to download the PDB-style file with coordinates for d1iqra1.
(The format of our PDB-style files is described here.)

Timeline for d1iqra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iqra2