Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily) alpha+beta fold |
Superfamily d.124.1: Ribonuclease Rh-like [55895] (1 family) |
Family d.124.1.1: Ribonuclease Rh-like [55896] (9 proteins) |
Protein S3-RNase [69809] (1 species) |
Species Japanese pear (Pyrus pyrifolia) [TaxId:3767] [69810] (1 PDB entry) |
Domain d1iqqa_: 1iqq A: [66274] |
PDB Entry: 1iqq (more details), 1.5 Å
SCOPe Domain Sequences for d1iqqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iqqa_ d.124.1.1 (A:) S3-RNase {Japanese pear (Pyrus pyrifolia) [TaxId: 3767]} ydyfqftqqyqlavcnsnrtlckdppdklftvhglwpsnmvgpdpskcpiknirkrekll ehqleiiwpnvfdrtknnlfwdkewmkhgscgyptidnenhyfetvikmyiskkqnvsri lskakiepdgkkralldienairngadnkkpklkcqkkgtttelveitlcsdksgehfid cphpfepisphycptnniky
Timeline for d1iqqa_: