Lineage for d1imua_ (1imu A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.204: Ribosome binding protein Y (HI0257, YfiA homologue) [69753] (1 superfamily) Superfamily d.204.1: Ribosome binding protein Y (HI0257, YfiA homologue) [69754] (1 family) 
Family d.204.1.1: Ribosome binding protein Y (HI0257, YfiA homologue) [69755] (1 protein) Protein Ribosome binding protein Y (HI0257, YfiA homologue) [69756] (1 species) Species Haemophilus influenzae [TaxId:727] [69757] (1 PDB entry) 
Domain d1imua_: 1imu A: [66218]
Details for d1imua_
PDB Entry: 1imu (more details)
PDB Description: solution structure of hi0257, a ribosome binding protein
SCOP Domain Sequences for d1imua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1imua_ d.204.1.1 (A:) Ribosome binding protein Y (HI0257, YfiA homologue) {Haemophilus influenzae}
mtlnitskqmditpairehleerlaklgkwqtqlisphfvlnkvpngfsveasigtplgn
llasatsddmykaineveeklerqlnklqhksesrraderlkdsfen
SCOP Domain Coordinates for d1imua_:
Click to download the PDB-style file with coordinates for d1imua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1imua_:
- d1imua_ first appeared in SCOP 1.59
- d1imua_ appears in SCOP 1.63
- d1imua_ appears in the current release, SCOPe 2.08
View in 3D