SCOPe 2.06: Domain d1il0b2: 1il0 B:12-203

Lineage for d1il0b2 (1il0 B:12-203)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [51874] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51875] (11 PDB entries)

8. Domain d1il0b2: 1il0 B:12-203 [66192]
   Other proteins in same PDB: d1il0a1, d1il0b1
   complexed with caa, nad; mutant

Details for d1il0b2

PDB Entry: 1il0, 2.2 Å

PDB Description: x-ray crystal structure of the e170q mutant of human l-3-hydroxyacyl- coa dehydrogenase

PDB Compounds: (B:) 3-hydroxyacyl-CoA dehydrogenase

SCOPe Domain Sequences for d1il0b2:

Sequence; same for both SEQRES and ATOM records:

>d1il0b2 c.2.1.6 (B:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa
enpkagdefvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkfaaehti
fasntsslqitsianattrqdrfaglhffnpvpvmklvqviktpmtsqktfeslvdfska
lgkhpvsckdtp

Timeline for d1il0b2:

• d1il0b2 first appeared in SCOP 1.59
  
• d1il0b2 appears in SCOPe 2.05
  
• d1il0b2 appears in SCOPe 2.07
  
• d1il0b2 appears in the current release, SCOPe 2.08