SCOP 1.59: Domain d1il0b1: 1il0 B:204-302

Lineage for d1il0b1 (1il0 B:204-302)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (7 families)

5. Family a.100.1.3: Short chain L-3-hydroxyacyl CoA dehydrogenase [48187] (1 protein)

6. Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48189] (7 PDB entries)

8. Domain d1il0b1: 1il0 B:204-302 [66191]
   Other proteins in same PDB: d1il0a2, d1il0b2

Details for d1il0b1

PDB Entry: 1il0, 2.2 Å

PDB Description: x-ray crystal structure of the e170q mutant of human l-3-hydroxyacyl- coa dehydrogenase

SCOP Domain Sequences for d1il0b1:

Sequence; same for both SEQRES and ATOM records:

>d1il0b1 a.100.1.3 (B:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens)}
gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd
gwhemdaenplhqpspslnklvaenkfgkktgegfykyk

Timeline for d1il0b1:

• d1il0b1 is new in SCOP 1.59
  
• d1il0b1 appears in SCOP 1.61
  
• d1il0b1 appears in the current release, SCOPe 2.08