| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.5: Exotoxin A, middle domain [56864] (1 family) ![]() automatically mapped to Pfam PF09102 |
| Family f.1.5.1: Exotoxin A, middle domain [56865] (1 protein) |
| Protein Exotoxin A, middle domain [56866] (1 species) six-helical domain |
| Species Pseudomonas aeruginosa [TaxId:287] [56867] (2 PDB entries) |
| Domain d1ikqa3: 1ikq A:252-394 [66187] Other proteins in same PDB: d1ikqa1, d1ikqa2 complexed with cl, na |
PDB Entry: 1ikq (more details), 1.62 Å
SCOPe Domain Sequences for d1ikqa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ikqa3 f.1.5.1 (A:252-394) Exotoxin A, middle domain {Pseudomonas aeruginosa [TaxId: 287]}
eggslaaltahqachlpletftrhrqprgweqleqcgypvqrlvalylaarlswnqvdqv
irnalaspgsggdlgeaireqpeqarlaltlaaaeserfvrqgtgndeagaanadvvslt
cpvaagecagpadsgdallerny
Timeline for d1ikqa3: