Lineage for d1ijvb_ (1ijv B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032898Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 3032899Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 3032900Family g.9.1.1: Defensin [57393] (11 proteins)
  6. 3032914Protein Beta-defensin, BD [63384] (7 species)
  7. 3032917Species Human (Homo sapiens), HBD1 [TaxId:9606] [64551] (4 PDB entries)
  8. 3032919Domain d1ijvb_: 1ijv B: [66170]
    complexed with br, k, so4

Details for d1ijvb_

PDB Entry: 1ijv (more details), 1.2 Å

PDB Description: human beta-defensin-1
PDB Compounds: (B:) beta-defensin 1

SCOPe Domain Sequences for d1ijvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijvb_ g.9.1.1 (B:) Beta-defensin, BD {Human (Homo sapiens), HBD1 [TaxId: 9606]}
dhyncvssggqclysacpiftkiqgtcyrgkakcck

SCOPe Domain Coordinates for d1ijvb_:

Click to download the PDB-style file with coordinates for d1ijvb_.
(The format of our PDB-style files is described here.)

Timeline for d1ijvb_:

3032919
d1ijvb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1ijva_