Lineage for d1ijuc_ (1iju C:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032898Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 3032899Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 3032900Family g.9.1.1: Defensin [57393] (11 proteins)
  6. 3032914Protein Beta-defensin, BD [63384] (7 species)
  7. 3032917Species Human (Homo sapiens), HBD1 [TaxId:9606] [64551] (4 PDB entries)
  8. 3032922Domain d1ijuc_: 1iju C: [66167]
    complexed with gol, so4

Details for d1ijuc_

PDB Entry: 1iju (more details), 1.4 Å

PDB Description: human beta-defensin-1
PDB Compounds: (C:) beta-defensin 1

SCOPe Domain Sequences for d1ijuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijuc_ g.9.1.1 (C:) Beta-defensin, BD {Human (Homo sapiens), HBD1 [TaxId: 9606]}
dhyncvssggqclysacpiftkiqgtcyrgkakcck

SCOPe Domain Coordinates for d1ijuc_:

Click to download the PDB-style file with coordinates for d1ijuc_.
(The format of our PDB-style files is described here.)

Timeline for d1ijuc_: