SCOPe 2.07: Domain d1igub_: 1igu B:

Lineage for d1igub_ (1igu B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families)
   the N-terminal domains of these repressors bind DNA

5. Family b.34.1.3: Transcriptional repressor protein KorB [69242] (1 protein)
   automatically mapped to Pfam PF06613

6. Protein Transcriptional repressor protein KorB [69243] (1 species)

7. Species Escherichia coli [TaxId:562] [69244] (2 PDB entries)

8. Domain d1igub_: 1igu B: [66135]

Details for d1igub_

PDB Entry: 1igu, 2.2 Å

PDB Description: c-terminal domain of the transcriptional repressor protein korb

PDB Compounds: (B:) Transcriptional repressor protein KorB

SCOPe Domain Sequences for d1igub_:

Sequence; same for both SEQRES and ATOM records:

>d1igub_ b.34.1.3 (B:) Transcriptional repressor protein KorB {Escherichia coli [TaxId: 562]}
pdpdklkkaivqvehderparlilnrrppaegyawlkyeddgqefeanladvklvalieg

Timeline for d1igub_:

• d1igub_ first appeared in SCOP 1.59
  
• d1igub_ appears in SCOPe 2.06
  
• d1igub_ appears in the current release, SCOPe 2.08