Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) |
Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain [52279] (1 family) |
Family c.23.11.1: Beta-D-glucan exohydrolase, C-terminal domain [52280] (1 protein) |
Protein Beta-D-glucan exohydrolase, C-terminal domain [52281] (1 species) |
Species Barley (Hordeum vulgare) [TaxId:4513] [52282] (6 PDB entries) |
Domain d1iexa2: 1iex A:389-603 [66128] Other proteins in same PDB: d1iexa1 |
PDB Entry: 1iex (more details), 2.2 Å
SCOP Domain Sequences for d1iexa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iexa2 c.23.11.1 (A:389-603) Beta-D-glucan exohydrolase, C-terminal domain {Barley (Hordeum vulgare)} lvllkngktstdapllplpkkapkilvagshadnlgyqcggwtiewqgdtgrttvgttil eavkaavdpstvvvfaenpdaefvksggfsyaivavgehpytetkgdnlnltipepglst vqavcggvrcatvlisgrpvvvqpllaasdalvaawlpgsegqgvtdalfgdfgftgrlp rtwfksvdqlpmnvgdahydplfrlgyglttnatk
Timeline for d1iexa2: