Lineage for d1id3e_ (1id3 E:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725671Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1725672Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1725673Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1725867Protein Histone H3 [47122] (6 species)
  7. 1725948Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [68986] (1 PDB entry)
  8. 1725950Domain d1id3e_: 1id3 E: [66116]
    Other proteins in same PDB: d1id3b_, d1id3c_, d1id3d_, d1id3f_, d1id3g_, d1id3h_
    protein/DNA complex; complexed with mn

Details for d1id3e_

PDB Entry: 1id3 (more details), 3.1 Å

PDB Description: crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions
PDB Compounds: (E:) histone h3

SCOPe Domain Sequences for d1id3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1id3e_ a.22.1.1 (E:) Histone H3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
phrykpgtvalreirrfqkstellirklpfqrlvreiaqdfktdlrfqssaigalqesve
aylvslfedtnlaaihakrvtiqkkeiklarrlrger

SCOPe Domain Coordinates for d1id3e_:

Click to download the PDB-style file with coordinates for d1id3e_.
(The format of our PDB-style files is described here.)

Timeline for d1id3e_: