Lineage for d1id3b_ (1id3 B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535113Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 535114Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 535115Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 535279Protein Histone H4 [47125] (4 species)
  7. 535319Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [68987] (1 PDB entry)
  8. 535320Domain d1id3b_: 1id3 B: [66113]
    Other proteins in same PDB: d1id3a_, d1id3c_, d1id3d_, d1id3e_, d1id3g_, d1id3h_

Details for d1id3b_

PDB Entry: 1id3 (more details), 3.1 Å

PDB Description: crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions

SCOP Domain Sequences for d1id3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1id3b_ a.22.1.1 (B:) Histone H4 {Baker's yeast (Saccharomyces cerevisiae)}
dniqgitkpairrlarrggvkrisgliyeevravlksflesvirdsvtytehakrktvts
ldvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d1id3b_:

Click to download the PDB-style file with coordinates for d1id3b_.
(The format of our PDB-style files is described here.)

Timeline for d1id3b_: