PDB entry 1id3

View 1id3 on RCSB PDB site
Description: crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions
Deposited on 2001-04-03, released 2001-09-28
The last revision prior to the SCOP 1.71 freeze date was dated 2001-09-28, with a file datestamp of 2001-09-28.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.223
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1id3a_
  • Chain 'B':
    Domains in SCOP 1.71: d1id3b_
  • Chain 'C':
    Domains in SCOP 1.71: d1id3c_
  • Chain 'D':
    Domains in SCOP 1.71: d1id3d_
  • Chain 'E':
    Domains in SCOP 1.71: d1id3e_
  • Chain 'F':
    Domains in SCOP 1.71: d1id3f_
  • Chain 'G':
    Domains in SCOP 1.71: d1id3g_
  • Chain 'H':
    Domains in SCOP 1.71: d1id3h_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1id3A (A:)
    artkqtarkstggkaprkqlaskaarksapstggvkkphrykpgtvalreirrfqkstel
    lirklpfqrlvreiaqdfktdlrfqssaigalqesveaylvslfedtnlaaihakrvtiq
    kkeiklarrlrgers
    

    Sequence, based on observed residues (ATOM records): (download)
    >1id3A (A:)
    phrykpgtvalreirrfqkstellirklpfqrlvreiaqdfktdlrfqssaigalqesve
    aylvslfedtnlaaihakrvtiqkkeiklarrlrger
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1id3B (B:)
    sgrgkggkglgkggakrhrkilrdniqgitkpairrlarrggvkrisgliyeevravlks
    flesvirdsvtytehakrktvtsldvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1id3B (B:)
    dniqgitkpairrlarrggvkrisgliyeevravlksflesvirdsvtytehakrktvts
    ldvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1id3C (C:)
    sggkggkagsaakasqsrsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleyla
    aeilelagnaardnkktriiprhlqlairnddelnkllgnvtiaqggvlpnihqnllpkk
    sakatkasqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1id3C (C:)
    qsrsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleylaaeilelagnaardnk
    ktriiprhlqlairnddelnkllgnvtiaqggvlpnihqnllpkksakat
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1id3D (D:)
    ssaaekkpaskapaekkpaakktstsvdgkkrskvrketyssyiykvlkqthpdtgisqk
    smsilnsfvndiferiateasklaaynkkstisareiqtavrlilpgelakhavsegtra
    vtkyssstqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1id3D (D:)
    rketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisar
    eiqtavrlilpgelakhavsegtravtkyssst
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1id3E (E:)
    artkqtarkstggkaprkqlaskaarksapstggvkkphrykpgtvalreirrfqkstel
    lirklpfqrlvreiaqdfktdlrfqssaigalqesveaylvslfedtnlaaihakrvtiq
    kkeiklarrlrgers
    

    Sequence, based on observed residues (ATOM records): (download)
    >1id3E (E:)
    phrykpgtvalreirrfqkstellirklpfqrlvreiaqdfktdlrfqssaigalqesve
    aylvslfedtnlaaihakrvtiqkkeiklarrlrger
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1id3F (F:)
    sgrgkggkglgkggakrhrkilrdniqgitkpairrlarrggvkrisgliyeevravlks
    flesvirdsvtytehakrktvtsldvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1id3F (F:)
    hrkilrdniqgitkpairrlarrggvkrisgliyeevravlksflesvirdsvtytehak
    rktvtsldvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1id3G (G:)
    sggkggkagsaakasqsrsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleyla
    aeilelagnaardnkktriiprhlqlairnddelnkllgnvtiaqggvlpnihqnllpkk
    sakatkasqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1id3G (G:)
    kasqsrsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleylaaeilelagnaar
    dnkktriiprhlqlairnddelnkllgnvtiaqggvlpnihqnllpkk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1id3H (H:)
    ssaaekkpaskapaekkpaakktstsvdgkkrskvrketyssyiykvlkqthpdtgisqk
    smsilnsfvndiferiateasklaaynkkstisareiqtavrlilpgelakhavsegtra
    vtkyssstqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1id3H (H:)
    vrketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisa
    reiqtavrlilpgelakhavsegtravtkyssstqa