Lineage for d1i8ma2 (1i8m A:108-213)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453918Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 454044Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)
  8. 454144Domain d1i8ma2: 1i8m A:108-213 [66083]
    Other proteins in same PDB: d1i8ma1, d1i8mb1, d1i8mb2, d1i8mh1, d1i8mh2, d1i8ml1
    part of anti-ssDNA Fab

Details for d1i8ma2

PDB Entry: 1i8m (more details), 2.1 Å

PDB Description: crystal structure of a recombinant anti-single-stranded dna antibody fragment complexed with dt5

SCOP Domain Sequences for d1i8ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8ma2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOP Domain Coordinates for d1i8ma2:

Click to download the PDB-style file with coordinates for d1i8ma2.
(The format of our PDB-style files is described here.)

Timeline for d1i8ma2: