Lineage for d1i89a1 (1i89 A:2-235)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524267Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 2524329Protein Chalcone synthase [53915] (1 species)
  7. 2524330Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (16 PDB entries)
    Uniprot P30074
  8. 2524351Domain d1i89a1: 1i89 A:2-235 [66074]

Details for d1i89a1

PDB Entry: 1i89 (more details), 1.86 Å

PDB Description: chalcone synthase (g256l)
PDB Compounds: (A:) Chalcone synthase 2

SCOPe Domain Sequences for d1i89a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i89a1 c.95.1.2 (A:2-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]}
vsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmcd
ksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqpk
skithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgcfaggtvlrlakdlaenn
kgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekp

SCOPe Domain Coordinates for d1i89a1:

Click to download the PDB-style file with coordinates for d1i89a1.
(The format of our PDB-style files is described here.)

Timeline for d1i89a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i89a2