Lineage for d1i4sb_ (1i4s B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 545260Fold a.149: RNase III catalytic domain-like [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 545261Superfamily a.149.1: RNase III catalytic domain-like [69065] (1 family) (S)
  5. 545262Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
    Pfam 00636
  6. 545266Protein RNase III endonuclease catalytic domain [69067] (2 species)
  7. 545267Species Aquifex aeolicus [TaxId:63363] [69068] (4 PDB entries)
  8. 545274Domain d1i4sb_: 1i4s B: [66027]

Details for d1i4sb_

PDB Entry: 1i4s (more details), 2.15 Å

PDB Description: crystal structure of rnase iii endonuclease domain from aquifex aeolicus at 2.15 angstrom resolution

SCOP Domain Sequences for d1i4sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4sb_ a.149.1.1 (B:) RNase III endonuclease catalytic domain {Aquifex aeolicus}
mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids
grdanftrelfyklfkedilsaikegr

SCOP Domain Coordinates for d1i4sb_:

Click to download the PDB-style file with coordinates for d1i4sb_.
(The format of our PDB-style files is described here.)

Timeline for d1i4sb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i4sa_