Lineage for d1i4sb_ (1i4s B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101882Fold a.149: RNase III endonuclease domain [69064] (1 superfamily)
  4. 101883Superfamily a.149.1: RNase III endonuclease domain [69065] (1 family) (S)
  5. 101884Family a.149.1.1: RNase III endonuclease domain [69066] (1 protein)
  6. 101885Protein RNase III endonuclease domain [69067] (1 species)
  7. 101886Species Aquifex aeolicus [TaxId:63363] [69068] (2 PDB entries)
  8. 101892Domain d1i4sb_: 1i4s B: [66027]

Details for d1i4sb_

PDB Entry: 1i4s (more details), 2.15 Å

PDB Description: crystal structure of rnase iii endonuclease domain from aquifex aeolicus at 2.15 angstrom resolution

SCOP Domain Sequences for d1i4sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4sb_ a.149.1.1 (B:) RNase III endonuclease domain {Aquifex aeolicus}
mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids
grdanftrelfyklfkedilsaikegr

SCOP Domain Coordinates for d1i4sb_:

Click to download the PDB-style file with coordinates for d1i4sb_.
(The format of our PDB-style files is described here.)

Timeline for d1i4sb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i4sa_