Lineage for d1i4ma_ (1i4m A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016146Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1016147Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1016148Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1016149Protein Prion protein domain [54100] (13 species)
  7. 1016167Species Human (Homo sapiens) [TaxId:9606] [54103] (18 PDB entries)
  8. 1016168Domain d1i4ma_: 1i4m A: [66025]
    swapped dimer
    complexed with cd, cl

Details for d1i4ma_

PDB Entry: 1i4m (more details), 2 Å

PDB Description: Crystal structure of the human prion protein reveals a mechanism for oligomerization
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d1i4ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4ma_ d.6.1.1 (A:) Prion protein domain {Human (Homo sapiens) [TaxId: 9606]}
gavvgglggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhd
cvnitikqhtvttttkgenftetdvkmmervveqmcitqyeresqayy

SCOPe Domain Coordinates for d1i4ma_:

Click to download the PDB-style file with coordinates for d1i4ma_.
(The format of our PDB-style files is described here.)

Timeline for d1i4ma_: