Lineage for d1hzdf_ (1hzd F:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.14: ClpP/crotonase [52095] (1 superfamily) Superfamily c.14.1: ClpP/crotonase [52096] (3 families) 
Family c.14.1.3: Crotonase-like [52103] (5 proteins) 
Protein AUH protein [69440] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69441] (1 PDB entry) 
Domain d1hzdf_: 1hzd F: [65974]
Details for d1hzdf_
PDB Entry: 1hzd (more details), 2.2 Å
PDB Description: crystal structure of human auh protein, an rna-binding homologue of enoyl-coa hydratase
SCOP Domain Sequences for d1hzdf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hzdf_ c.14.1.3 (F:) AUH protein {Human (Homo sapiens)}
delrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsevp
gifcagadlkerakmsssevgpfvskiravindianlpvptiaaidglalggglelalac
dirvaassakmglvetklaiipggggtqrlpraigmslakelifsarvldgkeakavgli
shvleqnqegdaayrkaldlareflpqgpvamrvaklainqgmevdlvtglaieeacyaq
tiptkdrlegllafkekrpprykge
SCOP Domain Coordinates for d1hzdf_:
Click to download the PDB-style file with coordinates for d1hzdf_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hzdf_:
- d1hzdf_ first appeared in SCOP 1.59
- d1hzdf_ appears in SCOP 1.63
- d1hzdf_ appears in the current release, SCOPe 2.08
View in 3D
