Lineage for d1hiza_ (1hiz A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1569213Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1569694Protein Xylanase [51488] (6 species)
  7. 1569710Species Bacillus stearothermophilus, Xt6 [TaxId:1422] [69386] (5 PDB entries)
    Uniprot P40943
  8. 1569715Domain d1hiza_: 1hiz A: [65841]
    complexed with gla, glc, so4

Details for d1hiza_

PDB Entry: 1hiz (more details), 2.4 Å

PDB Description: xylanase t6 (xt6) from bacillus stearothermophilus
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d1hiza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hiza_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]}
syakkphisalnapqldqrykneftigaavepyqlqnekdvqmlkrhfnsivaenvmkpi
siqpeegkfnfeqadrivkfakangmdirfhtlvwhsqvpqwffldkegkpmvnetdpvk
reqnkqlllkrlethiktiverykddikywdvvnevvgddgklrnspwyqiagidyikva
fqaarkyggdniklymndyntevepkrtalynlvkqlkeegvpidgighqshiqigwpse
aeiektinmfaalgldnqiteldvsmygwpprayptydaipkqkfldqaarydrlfklye
klsdkisnvtfwgiadnhtwldsradvyydangnvvvdpnapyakvekgkgkdapfvfgp
dykvkpaywaiidhk

SCOPe Domain Coordinates for d1hiza_:

Click to download the PDB-style file with coordinates for d1hiza_.
(The format of our PDB-style files is described here.)

Timeline for d1hiza_: