SCOP 1.61: Domain d1hd8a1: 1hd8 A:263-356

Lineage for d1hd8a1 (1hd8 A:263-356)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.105: Penicillin-binding protein 5, C-terminal domain [69188] (1 superfamily)

4. Superfamily b.105.1: Penicillin-binding protein 5, C-terminal domain [69189] (1 family)

5. Family b.105.1.1: Penicillin-binding protein 5, C-terminal domain [69190] (1 protein)

6. Protein Penicillin-binding protein 5, C-terminal domain [69191] (1 species)

7. Species Escherichia coli [TaxId:562] [69192] (1 PDB entry)

8. Domain d1hd8a1: 1hd8 A:263-356 [65803]
   Other proteins in same PDB: d1hd8a2

Details for d1hd8a1

PDB Entry: 1hd8, 2.3 Å

PDB Description: crystal structure of a deacylation-defective mutant of penicillin-binding protein 5 at 2.3 a resolution

SCOP Domain Sequences for d1hd8a1:

Sequence; same for both SEQRES and ATOM records:

>d1hd8a1 b.105.1.1 (A:263-356) Penicillin-binding protein 5, C-terminal domain {Escherichia coli}
fetvnplkvgkefasepvwfgdsdraslgvdkdvyltiprgrmkdlkasyvlnsselhap
lqknqvvgtinfqldgktieqrplvvlqeipegn

Timeline for d1hd8a1:

• d1hd8a1 first appeared in SCOP 1.59
  
• d1hd8a1 appears in SCOP 1.63
  
• d1hd8a1 appears in the current release, SCOPe 2.08