SCOPe 2.04: Domain d1hb5c_: 1hb5 C:

Lineage for d1hb5c_ (1hb5 C:)

1. Root: SCOPe 2.04

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)

4. Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family)

5. Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)

6. Protein p3 shell [69996] (1 species)

7. Species Bacteriophage PRD1 [TaxId:10658] [69997] (5 PDB entries)

8. Domain d1hb5c_: 1hb5 C: [65754]

Details for d1hb5c_

PDB Entry: 1hb5, 12 Å

PDB Description: quasi-atomic resolution model of bacteriophage prd1 p3-shell, obtained by combined cryo-em and x-ray crystallography.

PDB Compounds: (C:) bacteriophage prd1 p3-shell

SCOPe Domain Sequences for d1hb5c_:

Sequence; same for both SEQRES and ATOM records:

>d1hb5c_ i.6.1.1 (C:) p3 shell {Bacteriophage PRD1 [TaxId: 10658]}
alrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvt
aaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssm
vtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlk
lefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqngyilplid
lstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinylsqrtanf
sdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpktvnqnarl
lmgyeyftsrt

Timeline for d1hb5c_:

• d1hb5c_ first appeared in SCOP 1.59
  
• d1hb5c_ appears in SCOPe 2.03
  
• d1hb5c_ appears in SCOPe 2.05
  
• d1hb5c_ appears in the current release, SCOPe 2.08