Lineage for d1hb5c_ (1hb5 C:)
- Root: SCOP 1.61
Class i: Low resolution protein structures [58117] (17 folds) 
Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily) Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) 
Family i.6.1.1: Viruses and virus-receptor complexes [58164] (8 proteins) 
Protein p3 shell [69996] (1 species) Species Bacteriophage prd1 [TaxId:10658] [69997] (5 PDB entries) 
Domain d1hb5c_: 1hb5 C: [65754]
Details for d1hb5c_
PDB Entry: 1hb5 (more details), 12 Å
PDB Description: quasi-atomic resolution model of bacteriophage prd1 p3-shell, obtained by combined cryo-em and x-ray crystallography.
SCOP Domain Sequences for d1hb5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hb5c_ i.6.1.1 (C:) p3 shell {Bacteriophage prd1}
alrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvt
aaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssm
vtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlk
lefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqngyilplid
lstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinylsqrtanf
sdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpktvnqnarl
lmgyeyftsrt
SCOP Domain Coordinates for d1hb5c_:
Click to download the PDB-style file with coordinates for d1hb5c_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hb5c_:
- d1hb5c_ first appeared in SCOP 1.59
- d1hb5c_ appears in SCOP 1.63
- d1hb5c_ appears in the current release, SCOPe 2.08
View in 3D
