Lineage for d1hb3a_ (1hb3 A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 171721Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 171830Superfamily b.82.2: Clavaminate synthase-like [51197] (5 families) (S)
  5. 171831Family b.82.2.1: Penicillin syntase-like [51198] (3 proteins)
  6. 171846Protein Isopenicillin N synthase [51199] (1 species)
  7. 171847Species Emericella nidulans [TaxId:162425] [51200] (10 PDB entries)
  8. 171852Domain d1hb3a_: 1hb3 A: [65750]

Details for d1hb3a_

PDB Entry: 1hb3 (more details), 1.4 Å

PDB Description: isopenicillin n synthase from aspergillus nidulans (oxygen exposed product from anaerobic acov fe complex)

SCOP Domain Sequences for d1hb3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hb3a_ b.82.2.1 (A:) Isopenicillin N synthase {Emericella nidulans}
svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
ngksdreplsygdylqnglvslinkngqt

SCOP Domain Coordinates for d1hb3a_:

Click to download the PDB-style file with coordinates for d1hb3a_.
(The format of our PDB-style files is described here.)

Timeline for d1hb3a_: