| Class h: Coiled coil proteins [57942] (6 folds) | 
| Fold h.1: Parallel coiled-coil [57943] (26 superfamilies) this is not a true fold; includes oligomers of shorter identical helices  | 
Superfamily h.1.3: Leucine zipper domain [57959] (1 family) ![]()  | 
| Family h.1.3.1: Leucine zipper domain [57960] (14 proteins) | 
| Protein C/ebp beta [57985] (2 species) | 
| Species Human (Homo sapiens) [TaxId:9606] [64590] (7 PDB entries) | 
| Domain d1h8aa_: 1h8a A: [65729] Other proteins in same PDB: d1h8ac1, d1h8ac2  | 
PDB Entry: 1h8a (more details), 2.23 Å
SCOP Domain Sequences for d1h8aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8aa_ h.1.3.1 (A:) C/ebp beta {Human (Homo sapiens)}
vdkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelst
lrnlfkql
Timeline for d1h8aa_: