Lineage for d1h8aa_ (1h8a A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039471Superfamily h.1.3: Leucine zipper domain [57959] (2 families) (S)
  5. 3039472Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)
  6. 3039503Protein C/ebp beta [57985] (2 species)
  7. 3039504Species Human (Homo sapiens) [TaxId:9606] [64590] (10 PDB entries)
  8. 3039515Domain d1h8aa_: 1h8a A: [65729]
    Other proteins in same PDB: d1h8ac1, d1h8ac2
    protein/DNA complex

Details for d1h8aa_

PDB Entry: 1h8a (more details), 2.23 Å

PDB Description: crystal structure of ternary protein-dna complex3
PDB Compounds: (A:) caat/enhancer binding protein beta

SCOPe Domain Sequences for d1h8aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8aa_ h.1.3.1 (A:) C/ebp beta {Human (Homo sapiens) [TaxId: 9606]}
vdkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelst
lrnlfkql

SCOPe Domain Coordinates for d1h8aa_:

Click to download the PDB-style file with coordinates for d1h8aa_.
(The format of our PDB-style files is described here.)

Timeline for d1h8aa_: