| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (13 families) ![]() consists only of helices |
| Family a.4.1.3: Myb/SANT domain [46739] (6 proteins) |
| Protein c-Myb, DNA-binding domain [46740] (1 species) duplication |
| Species Mouse (Mus musculus) [TaxId:10090] [46742] (16 PDB entries) |
| Domain d1h89c2: 1h89 C:89-143 [65727] Other proteins in same PDB: d1h89a_, d1h89b_ |
PDB Entry: 1h89 (more details), 2.45 Å
SCOP Domain Sequences for d1h89c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h89c2 a.4.1.3 (C:89-143) c-Myb, DNA-binding domain {Mouse (Mus musculus)}
elikgpwtkeedqrviklvqkygpkrwsviakhlkgrigkqcrerwhnhlnpevk
Timeline for d1h89c2: