| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
| Family a.4.1.3: Myb/SANT domain [46739] (16 proteins) |
| Protein c-Myb, DNA-binding domain [46740] (1 species) duplication |
| Species Mouse (Mus musculus) [TaxId:10090] [46742] (16 PDB entries) |
| Domain d1h88c3: 1h88 C:144-190 [65723] Other proteins in same PDB: d1h88a_, d1h88b_ protein/DNA complex; complexed with nh4 |
PDB Entry: 1h88 (more details), 2.8 Å
SCOPe Domain Sequences for d1h88c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h88c3 a.4.1.3 (C:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
ktswteeedriiyqahkrlgnrwaeiakllpgrtdnaiknhwnstmr
Timeline for d1h88c3: