Lineage for d1h88c3 (1h88 C:144-190)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 532781Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 532956Family a.4.1.3: Myb/SANT domain [46739] (7 proteins)
  6. 532964Protein c-Myb, DNA-binding domain [46740] (1 species)
    duplication
  7. 532965Species Mouse (Mus musculus) [TaxId:10090] [46742] (16 PDB entries)
  8. 532973Domain d1h88c3: 1h88 C:144-190 [65723]
    Other proteins in same PDB: d1h88a_, d1h88b_
    complexed with nh4; mutant

Details for d1h88c3

PDB Entry: 1h88 (more details), 2.8 Å

PDB Description: crystal structure of ternary protein-dna complex1

SCOP Domain Sequences for d1h88c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h88c3 a.4.1.3 (C:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus)}
ktswteeedriiyqahkrlgnrwaeiakllpgrtdnaiknhwnstmr

SCOP Domain Coordinates for d1h88c3:

Click to download the PDB-style file with coordinates for d1h88c3.
(The format of our PDB-style files is described here.)

Timeline for d1h88c3: